🌱WordSprout
Word Lists
Fry word lists & PDFsDolch word listsBy grade level
Printables
Create a worksheet packPrintable flashcardsReady-made Fry pack
Practice
Start free practiceGamesFlashcards
For Teachers
Word ListsFry word lists & PDFsDolch word listsBy grade level
PrintablesCreate a worksheet packPrintable flashcardsReady-made Fry pack
PracticeStart free practiceGamesFlashcards
For Teachers
Sign InCreate Worksheet

🌱 WordSprout

Making sight word learning fun and effective for children ages 4-7.

Sight Words

  • Dolch Words
  • Fry Words
  • Kindergarten
  • 1st Grade

Resources

  • Flashcards
  • Worksheets
  • Games
  • For Teachers
  • Blog

Company

  • About
  • Contact
  • Privacy Policy
  • Terms of Service

© 2026 WordSprout. All rights reserved.

Free resources for families & teachers

Fry First 300
Sight Words

Find your word list, print a checklist, and practice a few words at a time. Start with the first 100 or choose the group your teacher uses.

Download free PDFPractice 10 words

Word list + checklists · US Letter · No account needed. Download A4 instead

View all 300 words below
Actual PDF sample: Fry First 100 word list in four columns

Preview the free printable

Words 1–100Words 101–200Words 201–300

Fry First 100 Words

100 words · alphabetical within this group

Choose a set of 10
aaboutallamanandareasatbebeenbutbycalledcancomecoulddaydiddodowneachfindfirstforfromgetgohadhashaveheherhimhishowIifinintoisititslikelonglookmademakemanymaymoremynonotnownumberofononeorotheroutpartpeoplesaidseeshesosomethanthatthetheirthemthentherethesetheythistimetotwoupusewaswaterwaywewerewhatwhenwhichwhowillwithwordswouldwriteyouyour
Download this groupPractice the first 10Make worksheets

Fry Second 100 Words

100 words · alphabetical within this group

Choose a set of 10
afteragainairalsoAmericaanimalanotheransweranyaroundaskawaybackbecausebeforebigboycamechangedifferentdoesendevenfollowformfoundgivegoodgreathandhelpherehomehousejustkindknowlandlargelearnletterlinelittlelivemanmemeansmenmostmothermovemuchmustnameneednewoffoldonlyouroverpagepictureplaceplaypointputreadrightsamesaysentencesetshouldshowsmallsoundspellstillstudysuchtaketellthingsthinkthreethroughtootryturnusverywantwellwentwherewhyworkworldyears
Download this groupPractice the first 10Make worksheets

Fry Third 100 Words

100 words · alphabetical within this group

Choose a set of 10
aboveaddalmostalongalwaysbeganbeginbeingbelowbetweenbookbothcarcarrychildrencityclosecountrycutdon'teartheatenougheveryexampleeyesfacefamilyfarfatherfeetfewfoodfourgirlgotgroupgrowhardheadhearhighideaimportantIndianit'skeeplastlateleaveleftletlifelightlistmightmilemissmountainsnearnevernextnightoftenonceopenownpaperplantrealriverrunsawschoolseasecondseemsidesomethingsometimessongsoonstartstatestopstorytalkthosethoughttogethertooktreeunderuntilwalkwatchwhilewhitewithoutyoung
Download this groupPractice the first 10Make worksheets

How to use these lists

  1. Choose the group used at school, or start with the first 100.
  2. Ask the learner to read a small set. Mark words that need support on the checklist.
  3. Connect letters to sounds, explain unfamiliar spellings, and practice in a sentence. Revisit the words on another day.

Word groups follow the SightWords.com published Fry groups, checked September 2026. Words are alphabetical within each group, not individually ranked here. School lists and editions may vary; follow your teacher’s sequence. Our PDF layouts and activities are created by WordSprout.

Make the next lesson easier

Turn a few focus words into a practice pack

Choose 10 words, then create tracing, sentence and check-up pages. The custom generator is free, with no account required.

Create a free practice pack

Prefer ready-made pages? Preview the complete Fry practice pack.